<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06175
| Description |
Endoplasmic reticulum-Golgi intermediate compartment protein 2 |
| Sequence | MFGVRQRKKPVISFMERLDAFPKIRQSVRMEYSASHVFLAFLVIVIWLIYCEFLYFSEIYYAYTFTVDTSFKEYGGAFDFFAVGFSVYSQLTLYVDLTVATKCEYLATSMDGVKQKSLASSEEISMVPVRFKLSPDAQLYWNMLRNVRELHVPERLHHLSERNSLGFEIWRHLHEFAVDRQNNASSTETAIVDACRIHGYFLMNKLRGFNFSHRIEKFGFGPRIAGIINPLDGFQKESFDRRDMFYYYIQVVPTKITDLNGMETFTSQYSVTHKRRIIDHDQGSHGSCGIFIYFDFAPMMVLIRKSKTSLFVFALRICAIVGGIFACTGNCMEEYNGDVINNFRQAVKSCLTLLSVPVKTRHIEADEIKTTAEVATHRLIEAARRSERHFVRLYALFSAYCPEEVLKEEINDMKQEIERKKNMLLKHEEKMIAWEQILSEAETPLTS |
| Length | 447 |
| Position | Head |
| Organism | Trichinella patagoniensis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.110 |
| Instability index | 46.74 |
| Isoelectric point | 7.63 |
| Molecular weight | 51960.34 |
| Publications | |
Function
| Annotated function |
Possible role in transport between endoplasmic reticulum and
Golgi.
|
| GO - Cellular Component | endoplasmic reticulum-Golgi intermediate compartment membrane GO:0033116 IEA:UniProtKB-SubCell
integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06175
No repeats found
|