<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06134
Description |
Mediator of RNA polymerase II transcription subunit 24 |
Sequence | MEELSLSPMDHLLIDAWRECWPDLVFVRQLRRRIEINDENIEQLSSVLLYYATLSEMPNRLMLKYLKFCLDTQVIPCVAFLNVVNSYRSYEKEECIHEILPLVIDSFANLNCDFCDADVCVRTSILVMNTVLWILAYVEYLLTANNFSPLAHISRLIFTLKENKFVQFCSYFVSWELPEFHDQIKASIHNIKDKIEQNREFIRPDLTDNMLTFLSFLDIERNSYDNLFSANRNEILAQSVRASNSRIPSVVISLSGIFAHVQSMKGIADMVEALKVAKDIQGESWLNVIHDLIMGGILQQHDDSTTLPFSVSSSYLYLRIVLPDYFFRSLTIN |
Length | 333 |
Position | Tail |
Organism | Trichinella pseudospiralis (Parasitic roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.113 |
Instability index | 55.21 |
Isoelectric point | 5.00 |
Molecular weight | 38634.12 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06134
No repeats found
|