<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06126

Description Pyrroline-5-carboxylate reductase
SequenceMSDRLTQLQDCINELASQICNSTGVLQQAAPPSNFENNDQFSTGAEDNAELFAKLVASTSSDIDMLVDLLPNEEPSQDLQKEQFSELNHLNSEAAESLRLSVERGQVLLERIKNIFITMTTQKISPSEDSFFNMNIGFVGAGKMGQAMIRGKFAAQKITASAPVEDRHYLDEISKVNINVTHSNLDLARTSDVIIFAIPPSISWTVVSEMKNTLNNDKLILSIMNGVAMNTIEQAAGKKLRIARAMPNMAATVRRSATAYALNERCTSEDEALVNGLLSCVGCAVRLPENLINSATGLSGCGPAYMFTVLEAMAEGGVKAGLPRDIAQQLAVNTMLGSAEMVIQTGKHPTILRESIESPGGSTVVGVHELEKAAFRSALINAVEAATNHAFKQDNIQI
Length398
PositionMiddle
OrganismTrichinella pseudospiralis (Parasitic roundworm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella.
Aromaticity0.04
Grand average of hydropathy-0.079
Instability index46.36
Isoelectric point4.97
Molecular weight42929.34
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
pyrroline-5-carboxylate reductase activity	GO:0004735	IEA:UniProtKB-EC
GO - Biological Process
L-proline biosynthetic process	GO:0055129	IEA:UniProtKB-UniPathway

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP06126
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.31|      33|      41|      17|      50|       1
---------------------------------------------------------------------------
   17-   50 (52.71/40.39)	SQICNSTGVLQQAAPPSNFEnNDQFSTGAEDNAE
   61-   93 (55.60/37.64)	SDIDMLVDLLPNEEPSQDLQ.KEQFSELNHLNSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     118.53|      25|      34|     282|     306|       3
---------------------------------------------------------------------------
  237-  261 (37.78/23.67)	GKKLRIARAMPNMAATVRRSATAYA
  282-  306 (42.83/27.73)	GCAVRLPENLINSATGLSGCGPAYM
  317-  341 (37.93/23.79)	GVKAGLPRDIAQQLAVNTMLGSAEM
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP06126 with Med21 domain of Kingdom Metazoa

Unable to open file!