<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06084
Description |
Mediator of RNA polymerase II transcription subunit 24 |
Sequence | MAIRDEMRKELYVQEGQPTINLVLRAEFTLQSIVKAFDAHQALERWPQMLNTMMSGKSLLYICAAAISIDQLNLLAERLIKITETYKEVVPVGEDAQKSLPPSHDLFDMSFLLLHRLSQYYSTTTCLRPGDPFFKTWYFSSAIDLVRNMFDPEDLPQLLKNVPLDLELATDVLSRLRVGQPGWLNIRTWYCIIDLIPSIVQVVLNEVLLDTISIEELKAKLNIYRAQRNK |
Length | 230 |
Position | Tail |
Organism | Trichinella sp. T6 |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella> unclassified Trichinella.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.004 |
Instability index | 44.83 |
Isoelectric point | 5.47 |
Molecular weight | 26515.59 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06084
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.90| 18| 49| 127| 146| 1
---------------------------------------------------------------------------
127- 146 (32.58/23.09) LRPGDPFF...KTWYfsSAIDLV
176- 196 (34.32/18.27) LRVGQPGWlniRTWY..CIIDLI
---------------------------------------------------------------------------
|