| Description | Mediator of RNA polymerase II transcription subunit 6 (Fragment) |
| Sequence | LNMNVHGSSQITNPLHIQWNPPWNPNWLSASNVLDCFTNTLNPFYDPNCLNEQVRIQRLSSEILSRVHGVEYILLHAAEPLFVIRKQYRQPNQNVTPLEDYYIIGGTVYQAPDLSSVFNSRLQSAISNVRSAFEEAKSYYRFNTSDGYYFKYKNEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDMLLNELSEKFPPALSLEESNENTQDGKMTSNEEPQTSAQSKNDQMESPALSASKKIKSDMN |
| Length | 245 |
| Position | Head |
| Organism | Trichinella sp. T6 |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella> unclassified Trichinella. |
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.784 |
| Instability index | 45.27 |
| Isoelectric point | 5.48 |
| Molecular weight | 28132.02 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP06077
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 94.63| 30| 59| 154| 185| 1
---------------------------------------------------------------------------
154- 185 (46.52/33.29) NEPPVEKVDTKKDDKtgDDKRVSVFQKYRMDM
215- 244 (48.11/28.28) NEEPQTSAQSKNDQM..ESPALSASKKIKSDM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.32| 22| 63| 5| 26| 3
---------------------------------------------------------------------------
5- 26 (44.53/27.51) VHGSSQI....TNPLHIQWNPPWNPN
27- 48 (37.08/21.83) WLSASNV....LDCFTNTLNPFYDPN
67- 92 (30.71/16.96) VHGVEYIllhaAEPLFVIRKQYRQPN
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DGYYFKYKN 2) LEDYYII 3) MESPALSASKKIKSDMN 4) MLLNELSEKFP | 146 98 229 185 | 154 104 245 195 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab