Description | Mediator of RNA polymerase II transcription subunit 6 (Fragment) |
Sequence | LNMNVHGSSQITNPLHIQWNPPWNPNWLSASNVLDCFTNTLNPFYDPNCLNEQVRIQRLSSEILSRVHGVEYILLHAAEPLFVIRKQYRQPNQNVTPLEDYYIIGGTVYQAPDLSSVFNSRLQSAISNVRSAFEEAKSYYRFNTSDGYYFKYKNEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDMLLNELSEKFPPALSLEESNENTQDGKMTSNEEPQTSAQSKNDQMESPALSASKKIKSDMN |
Length | 245 |
Position | Head |
Organism | Trichinella sp. T6 |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella> unclassified Trichinella. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.784 |
Instability index | 45.27 |
Isoelectric point | 5.48 |
Molecular weight | 28132.02 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06077 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 94.63| 30| 59| 154| 185| 1 --------------------------------------------------------------------------- 154- 185 (46.52/33.29) NEPPVEKVDTKKDDKtgDDKRVSVFQKYRMDM 215- 244 (48.11/28.28) NEEPQTSAQSKNDQM..ESPALSASKKIKSDM --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 112.32| 22| 63| 5| 26| 3 --------------------------------------------------------------------------- 5- 26 (44.53/27.51) VHGSSQI....TNPLHIQWNPPWNPN 27- 48 (37.08/21.83) WLSASNV....LDCFTNTLNPFYDPN 67- 92 (30.71/16.96) VHGVEYIllhaAEPLFVIRKQYRQPN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DGYYFKYKN 2) LEDYYII 3) MESPALSASKKIKSDMN 4) MLLNELSEKFP | 146 98 229 185 | 154 104 245 195 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab