<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06043
Description |
Mediator of RNA polymerase II transcription subunit 24 |
Sequence | MRKELYVQEGQPTINLVLRAEFTLQSIVKAFDAHQALERWPQMLNTMMSGKSLLYICAAAISIDQLNLLAERLIKITETYKEVVPVGEDAQKSVPPSHDLFDMSFLLLHRLSQYYSTTTCLRPGDPFFKTWYFSSAIDLVRNMFDPEDLPQLLKNVPLDLELATDVLSRLRVGQPGWLNIRTWYCIIDLIPSIVQVVLNEVLLDTISIEELKVCKQSL |
Length | 218 |
Position | Tail |
Organism | Trichinella sp. T9 |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella> unclassified Trichinella.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.100 |
Instability index | 46.39 |
Isoelectric point | 5.11 |
Molecular weight | 24987.86 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06043
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.90| 18| 49| 121| 140| 1
---------------------------------------------------------------------------
121- 140 (32.58/24.88) LRPGDPFF...KTWYfsSAIDLV
170- 190 (34.32/19.71) LRVGQPGWlniRTWY..CIIDLI
---------------------------------------------------------------------------
|