<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06000

Description Mediator of RNA polymerase II transcription subunit 23 (Fragment)
SequenceLKRLLDIPIPVHLQVDQRKSVEAVEKLIKTICDRKNNLLPAYFVITEIIKNLPEQRCFSHWRMADCFTEIIESFRPLAQLNSVCGRTFMTPIPGHVGFYFNAFWKLEALSLRFPLKGLLPYSQDLLNPQMRLLTHVFMHYTYRDAIAVLLGTAKPEKSRIPYFEEVITEIILELMFTAECDHSQLNPQAWRIISTQIIYLTLQQSICFTRLVKILHTKLTHYPYRYARNQLMWCLFNFLSGGMQKYSVEEFAVILDLYRLLYTGRDIFTVSGSDSSCVLMLAPTCIWIHILKKSPSMEVELPPTVNTQRKFLQEALKNKTQFNTDNYMVAVLCNAYSSTSEIFQQDLLPILLENLDNTRGHNSTQASGNFASNTTSSMPYPNGAVSEVKLRPLKLEFLDSVSVHVRMNIANSLIGTFGRFMQGKSAWPSPALVETYCRMLTYPDLEILGLKQFTSHIVLTAARHQCCEMMYICCEILNYRLFNIPSTYRVHAIVTLQQTLAFAKFQTNASLYWMLERTLLLQFQWYPHYEIFQAPFARLLNSFVAVAADGTKQSIAENEELMRIIILTLARSTVISNSDSCFIEGVYRELLNKLPSYSWPQSTLSVFPQVFCSHYTQQQQQQQQQQQQQQQQQQQQQPQQPQQQQQQQQPQPQQSNVVVGSSQQPQQQQQSRFLLKQQVDEEYIKHRTFGSELSLIDYFTNTSTSTVYLCLLWRLVYDTGELPAVSMKILEVLGPRKVLVHLKSLADFLVYETNSADVNRCVDVLNRLIFKYAVVPLERFMLTMLLRDYEGNDAFYALLIVMLLVQRSEELRSAVADCVAMLPSDYWHCQDWNDKYQAYQIKHAERTWSQVYVELSRASLTPNDCPLPVYFGTRCLQMLPVVDLLLQKLVESPAACLKFLDSTLSILGPLYRFHPYPVSFLYSTFRFYEKRLVESPAIKQKLALAVHGACVPSRDDHWLLSAEFVGWVGQATDRGPWVPDLNYYGALVRRLIDTFSEPRQQWSRKTDLRFVEFNNFQTHALYSICIELMSLPVGVVDVGNALVTLVTHWYSNSNSV
Length1056
PositionTail
OrganismTrichinella sp. T9
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella> unclassified Trichinella.
Aromaticity0.11
Grand average of hydropathy-0.085
Instability index50.36
Isoelectric point7.74
Molecular weight121983.43
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06000
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      95.77|      16|      16|     617|     632|       1
---------------------------------------------------------------------------
  617-  632 (33.76/18.27)	QQQQQQQQQQQQQQQQ
  634-  649 (32.96/17.66)	QQQQPQQPQQQQQQQQ
  663-  678 (29.04/14.67)	QQPQQQQQSRFLLKQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.72|      15|      85|     131|     145|       2
---------------------------------------------------------------------------
  131-  145 (28.85/17.85)	RLLTHVFMHYTYRDA
  213-  227 (28.86/17.86)	KILHTKLTHYPYRYA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     223.34|      46|      85|     403|     448|       3
---------------------------------------------------------------------------
  368-  401 (40.05/19.10)	............GNFASNTTSSM.PYPNGAVSEVKLRPLK.LEFLDSV
  403-  448 (77.83/43.70)	VHVRMNIANSLIGTFGRFMQGKS.AWPSPALVETYCRMLT.YPDLEIL
  450-  484 (49.68/25.37)	LK...QFTSHIVLTAARH........QCCEMMYICCEILN.YRLFNI.
  490-  532 (55.77/29.33)	VHAIVTLQQTL..AFAKFQTNASlYW...MLERTLLLQFQwYPHYEIF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     105.48|      26|     120|      27|      52|       6
---------------------------------------------------------------------------
   27-   52 (45.29/27.25)	LIKTICDRKNNLLPAYF..VITEIIKNL
  149-  174 (34.70/19.26)	LLGTAKPEKSRI.P.YFeeVITEIILEL
  175-  193 (25.50/12.32)	MFTAECDHSQLNPQAWR..II.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      84.92|      21|      41|     887|     908|       7
---------------------------------------------------------------------------
  714-  734 (19.63/ 8.90)	.RLVydtgELPAVSMKILE....VLG
  887-  908 (32.41/23.93)	QKLV....ESPAACLKFLDsTLSILG
  930-  948 (32.89/19.49)	KRLV....ESPAIKQKL...ALAVHG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06000 with Med23 domain of Kingdom Metazoa
Unable to open file!