Description | Mediator of RNA polymerase II transcription subunit 28 (Fragment) |
Sequence | LKLLNCFFFSLFYKIILSMEEYNGDVINNFRQAVKSCLTLLSVPVKTRHIEADEIKTTAEVATHRLIEAARRSERHFVRLYALFSAYCPEEVLKEEINDMKQEIERKKNMLLKHEEKMIAWEQILSEAETPLTS |
Length | 134 |
Position | Head |
Organism | Trichinella murrelli |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.234 |
Instability index | 67.35 |
Isoelectric point | 6.13 |
Molecular weight | 15767.14 |
Publications |
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP05971 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) LSEAE 2) MLLKHEEKMIAWE | 125 110 | 129 122 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab