<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05963
| Description |
Mediator of RNA polymerase II transcription subunit 24 (Fragment) |
| Sequence | LYLRIPRLLSQLVAEGIPKETLIGSLRRIATSEAVLNVSDTKARCNTLQAFLNVLSELGILEESEKDTLMAIRDEMRKELYVQEGQPTINLVLRAEFTLQSIVKAFDAHQALERWPQMLNTMMSGKSLLYICAAAISIDQLNLLAERLIKITETYKEVVPVGEDAQKSVPPSHDLFDMSFLLLHRLSQYYSTTTCLRPGDPFFKTWYFSSAIDLVRNMFDPEDLPQLLKNVPLDLELATDVLSRLRVGQPGWLNIRTWYCIIDLIPSIVQVVLNEVLLDTISIEELKVCKQSL |
| Length | 293 |
| Position | Tail |
| Organism | Trichinella murrelli |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.096 |
| Instability index | 44.58 |
| Isoelectric point | 5.08 |
| Molecular weight | 33310.43 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05963
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 108.04| 32| 48| 196| 234| 1
---------------------------------------------------------------------------
196- 234 (51.33/57.23) LRPGDPFF...KTWYfsSAIDLVrnmfdPEDLPQLLKNVPLD
245- 279 (56.71/40.53) LRVGQPGWlniRTWY..CIIDLI.....PSIVQVVLNEVLLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.03| 12| 48| 9| 23| 2
---------------------------------------------------------------------------
9- 23 (16.79/22.11) LSQLvaeGI....PKETLI
55- 70 (16.25/10.74) LSEL...GIleesEKDTLM
---------------------------------------------------------------------------
|