| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MDESDSASVSSSQTRDSSGILRTKIALGRKPSVIMPFYMMKNELPSPSPITGSMNLLSYYGLDHAFNKFCNNKKLKEELSAFLPNLPGNIDTPAQKDGRQICSNFLFEKPPICGKEILPLSNSDLAGFRLLPGSIPEEYQLWNVGAEIVNDKKKRKRKHELLSAGESAEDDVEKRLKRMKKEEEKKEKKKKKKDKKKKKMMESEPVYSAPVISQASDFLDF |
| Length | 221 |
| Position | Head |
| Organism | Trichinella murrelli |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.774 |
| Instability index | 59.35 |
| Isoelectric point | 9.29 |
| Molecular weight | 25005.57 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP05953
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.38| 25| 43| 70| 95| 1
---------------------------------------------------------------------------
70- 95 (41.17/27.49) CNNKKL...KEELSAFlPNLPGNIDTPAQ
113- 140 (40.21/22.62) CGKEILplsNSDLAGF.RLLPGSIPEEYQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.53| 11| 37| 152| 162| 2
---------------------------------------------------------------------------
152- 162 (18.45/ 9.24) KKKRKRKHELL
191- 201 (19.07/ 9.75) KKKDKKKKKMM
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EKRLKRMKKEEEKKEKKKKKKDKKKKKMMESEPVYSAPVISQASD 2) ILRTKIALGRKPSVIMPFYMM | 173 20 | 217 40 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab