<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05934
| Description |
Mediator of RNA polymerase II transcription subunit 27 |
| Sequence | MYKPERPDIKFTIAEVNNSARRSKSIGQYHTILNNTFCRSCNVTSLISVLKDDLLFSVVRKIYPMNQNQSGTVSIPIELAEVTVMQGLRAVRDLRQSMSRLFDTLKDIRETPVTDEKAEESDLWLNFKSTLQKIMDNFEILEKCAVSLSKQPVQFLHPNLNQQIRSYCTDEAQIYPDIVYVYEWVKRIRESAQWLYNFVSQMSRRSQSRCLRKVFMPVFLQVNLTFLSHLFPMIQRQFPGVHIFSLPLGRSVFMLLVSFNVQTSAVDALRGPCTIFKVAILLRGLQIEWANVKGPEELNQNCLEKVFIYLTLCIFY |
| Length | 316 |
| Position | Tail |
| Organism | Trichinella nelsoni |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia>
Trichinellida> Trichinellidae> Trichinella.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.053 |
| Instability index | 52.94 |
| Isoelectric point | 9.06 |
| Molecular weight | 36730.37 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05934
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.59| 9| 93| 210| 220| 3
---------------------------------------------------------------------------
210- 220 (13.33/13.17) CLRKVFmpVFL
302- 310 (18.26/ 9.25) CLEKVF..IYL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.75| 14| 68| 120| 133| 5
---------------------------------------------------------------------------
120- 133 (26.17/16.95) ESDLWL.NFKSTLQK
190- 204 (22.58/13.76) ESAQWLyNFVSQMSR
---------------------------------------------------------------------------
|