Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDINFNRWMNKHVKRIYCLNMNVHGSSQITNPLHIQWNPPWNPNWLSASNVLDCFTNTLNPFYDPNCLNEQVRIQRLSSEILSRVHGVEYILLHAAEPLFVIRKQYRQPNQNVTPLEDYYIIGGTVYQAPDLSSVFNSRLQSAISNVRSAFEEGIRFFSYFNAKVTCDCFCIIAKSYYRFNTSDGYYFQYKNEPPVEKVDTKKDDKTGDDKRVSVFQKYRMDMLLNELSEKFPPALSLEESNENTQDGKMTSNEEPQTSAQSKNDQMESPALPASKKIKSDMN |
Length | 283 |
Position | Head |
Organism | Trichinella nelsoni |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.660 |
Instability index | 46.84 |
Isoelectric point | 6.24 |
Molecular weight | 32822.57 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05924 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 78.13| 23| 64| 181| 205| 1 --------------------------------------------------------------------------- 181- 205 (37.12/29.18) NTSDGYyfQYKNEPPVEKVDTKKDD 244- 266 (41.00/24.74) NTQDGK..MTSNEEPQTSAQSKNDQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 109.97| 22| 64| 23| 44| 2 --------------------------------------------------------------------------- 23- 44 (43.93/25.85) VHGSSQI....TNPLHIQWNPPWNPN 45- 66 (35.69/19.80) WLSASNV....LDCFTNTLNPFYDPN 85- 110 (30.35/15.89) VHGVEYIllhaAEPLFVIRKQYRQPN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KNDQMESPALPASKKIKSDMN 2) MLLNELSEKFPPALSLEE | 263 223 | 283 240 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab