<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05911

Description Transcription elongation factor A protein 2
SequenceMAQVKPREDDLIRYGKKLDKVVNGEKSEQSAMDILKILRATPMTVELLQKTRIGMTVNELRKKTTDRSLQVEAKNLIRHWKKLIECKSASSKSSGSSSSSSSAAAANSVNLTRNDSVASNMSEGGRSNDSDGVASTPIRPRPFQKNTTFPPQMTDVREKCRQMLLKSLEPDLNSPEISVLTRERLAAEIEQEIYSLFNNTGDRYCACVRSRVFNLRDKKNPDLKRSVLSGEITAIRLATMTSEEMASEALKAARRKFTKEAIEEHQVAQEVGTPTDMFKCGKCHKKNCTYTQAQTRSADEPMTTFVYCRECGNRWKFC
Length318
PositionUnknown
OrganismTrichinella nelsoni
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Enoplea> Dorylaimia> Trichinellida> Trichinellidae> Trichinella.
Aromaticity0.05
Grand average of hydropathy-0.691
Instability index55.22
Isoelectric point9.35
Molecular weight35764.44
Publications

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
translation elongation factor activity	GO:0003746	IEA:UniProtKB-KW
zinc ion binding	GO:0008270	IEA:InterPro
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP05911
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     105.68|      34|      62|     155|     188|       1
---------------------------------------------------------------------------
  155-  188 (55.47/40.15)	DVREKCRQMLLKS.LEPDLNSPEISVLTRERLAAE
  214-  248 (50.21/35.68)	NLRDKKNPDLKRSvLSGEITAIRLATMTSEEMASE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.81|      14|      64|       3|      18|       2
---------------------------------------------------------------------------
    3-   18 (21.27/24.07)	QVKPRedDLIRYGKKL
   70-   83 (26.54/20.76)	QVEAK..NLIRHWKKL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP05911 with Med26 domain of Kingdom Metazoa

Unable to open file!