<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05891
Description |
Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MADSFNLPLRPVIQNRDRPDSLSRDIAQINAQWGSFRELSEASLREKIEADKNKDPWEEEDEVEKEAADLDTSERMEQLYKRRAEIIQFALQAHMEASFALDFVSLLLSKYNPRQAETSMSPFLKTAAPLGSLNSEVINPPPRPDTALKDIKSVSRGWRLQNFNSAASKLLNAGARLDTEVDAEKEYWDQVLAIKEKGWKVCRLPRDGQALGVQYGFLEGEAYYLLSGCR |
Length | 230 |
Position | Head |
Organism | Aspergillus calidoustus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.607 |
Instability index | 34.48 |
Isoelectric point | 5.03 |
Molecular weight | 26110.07 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05891
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.32| 22| 124| 12| 33| 1
---------------------------------------------------------------------------
12- 33 (39.95/21.84) VIQNRDRPDSLSRDIAQINAQW
137- 158 (41.37/22.81) VINPPPRPDTALKDIKSVSRGW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.73| 22| 129| 38| 59| 2
---------------------------------------------------------------------------
38- 59 (37.16/22.50) ELSEASLREKIEADKNKDPWEE
169- 190 (37.57/22.81) KLLNAGARLDTEVDAEKEYWDQ
---------------------------------------------------------------------------
|