| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MADGNDSNGQVKVFTSADRIRQLNEIDKDVAKLIHSAGLAIQALTNARAGDLSATDTSLDSHKARFKEATSQYFALLSSIDVRLRRQVYALEEASILAPDSSSRGGDLAGAGAGASNVSNPLDVSWLNSRKDTVGKEKEAELWAAAREFVQQMEQVQSGDKDRVKVEGGQENMEVD |
| Length | 176 |
| Position | Head |
| Organism | Aspergillus calidoustus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Nidulantes. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.514 |
| Instability index | 28.14 |
| Isoelectric point | 4.93 |
| Molecular weight | 18967.70 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP05873
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.49| 18| 26| 52| 69| 1
---------------------------------------------------------------------------
52- 69 (29.07/19.94) LSATDTSLDSHKARFKEA
77- 94 (28.42/19.36) LSSIDVRLRRQVYALEEA
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DKDRVKV 2) EKEAELWAAAREF | 160 137 | 166 149 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab