Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MNAQLSSALDGLENKLNALLSSLTTPTAAGAPTAAISLLEADDVVTSALDTLRTHQANYTKILRLRDEAESLEERIKGIVRDISGAGQEIVEATGGNDDGDYTDDESDTDSDSANVTEKPRKRSRKEVDYRLLLDFARRISKYNKEAAADAASGIGTGQKKKLQGKQTDANGIDTTAETDAQEAPVENVTKEATNWLDQTADADRQVFMIPYPNEDRIRMGLMGQLQMAAIDKNLDLDKEAERMVLEAEGAGVATAIPEAGAGGPDNTLAGEAAKAAAQAGSQVAERGAHSAARAPAPQPKAMLDLDLYDPDEDD |
Length | 315 |
Position | Middle |
Organism | Talaromyces islandicus (Penicillium islandicum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces> Talaromyces sect. Islandici. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.602 |
Instability index | 23.88 |
Isoelectric point | 4.44 |
Molecular weight | 33471.40 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05872 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 132.70| 43| 69| 85| 129| 1 --------------------------------------------------------------------------- 85- 129 (63.61/36.33) GAGQEiVEATGGNDDGDYTDDESDTDSDSANVtEKPRKRSRKEVD 156- 198 (69.10/32.43) GTGQK.KKLQGKQTDANGIDTTAETDAQEAPV.ENVTKEATNWLD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GEAAKAAAQAGSQVAERGAHSAARAPAPQPKAMLDLDLYDPDEDD 2) VFMIPY | 271 207 | 315 212 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab