<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05856
Description |
RNA polymerase II holoenzyme cyclin-like subunit |
Sequence | MAANYWVSTQRRHWMFTRERLAEIRESLWASNKDNHQVQLPDMRIINIYFKDQICRLAKRMNSRQQAVATAQVYMKRFYTKVDFRQTNPYLVMVTAFYLACKMEECPQHIRFIAAEAQFVANDPAKIGECEFYLISEMSSQLIVHHPYRTVSELSTELELSVDEANQASNLISDHYQTDLPLLYPPHIIGVMAVLLAVLFSSSQRGSHMSMAPSIAASLREGGMGAAMSALGADRQGTGRPDPRIQKVVNWLAESEVDIRAVIECTQEMVSLYELMEGFNLQQVKEVITRMMKTKSMDK |
Length | 299 |
Position | Kinase |
Organism | Talaromyces islandicus (Penicillium islandicum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces>
Talaromyces sect. Islandici.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.215 |
Instability index | 52.21 |
Isoelectric point | 6.72 |
Molecular weight | 34228.12 |
Publications | |
Function
Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
ECO:0000256 ARBA:ARBA00002306
ECO:0000256 ARBA:ARBA00003882
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05856
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.76| 15| 22| 47| 65| 1
---------------------------------------------------------------------------
47- 65 (20.98/21.67) NIYFKdqicRLAKRMNSRQ
72- 86 (27.78/15.91) QVYMK....RFYTKVDFRQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 126.38| 38| 192| 8| 45| 3
---------------------------------------------------------------------------
8- 45 (70.16/37.43) STQR.RHWMFTRERLAEIRE.....SLWASNKDNHQVQLPDMRI
202- 245 (56.21/28.93) SSQRgSHMSMAPSIAASLREggmgaAMSALGADRQGTGRPDPRI
---------------------------------------------------------------------------
|