Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSVSASNYATNITSSQPPSQATSQPANLSSPPSSAPMSTQTSQQPTLGPTNSFPTPASSVSGHFMGPTSVEDSEHAGTSFEHVQADSGATTATGLHASSTQRSEHRRTDHDRELEGPTPGIDVRNFAGMDVPLTRDDADAMDVDKDVNASAKSDGLSLESLQQDFSSTFHLCKSSHIATGPDPALDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHDPSTPGGLRHLTMWPEEEWQNQKVYGKEIKVADVDSALHNLQMKAMQMEPGTVPNNEYWEDVLGHEKPSKHAGHGDGKKAATLHNTARSPSQANETPLPTEPERARPRRGRKRHYDDNSFVGYGEGYADDDDDAAFYSNSEGMGKKKRKKEHVPKVSTPLPDRGGSYGVGMFGIGAR |
Length | 413 |
Position | Head |
Organism | Aspergillus lentulus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.855 |
Instability index | 45.09 |
Isoelectric point | 6.19 |
Molecular weight | 44437.42 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05848 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 168.09| 56| 60| 38| 95| 1 --------------------------------------------------------------------------- 6- 72 (89.20/44.20) SNYA.TNITSSQPPSQATsqpanlssppSSAPM...STQTSQQPTLGPTNSF..PTPASSVSgHFMG...PTSVED 73- 137 (78.88/38.76) SEHAgTSFEHVQADSGAT..........TATGLhasSTQRSEHRRTDHDRELegPTPGIDVR.NFAGmdvPLTRDD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 121.56| 34| 44| 219| 252| 2 --------------------------------------------------------------------------- 219- 252 (62.47/34.40) EGKLKGLGLAGRNKPVKHDPSTPGGLRHLTMWPE 264- 297 (59.09/32.18) EIKVADVDSALHNLQMKAMQMEPGTVPNNEYWED --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DDAAFYSN 2) KKKRKKEHVPKVSTPL 3) VGYGEGY 4) YGVGMFGIGAR | 368 381 357 403 | 375 396 363 413 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab