<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05822
Description |
Uncharacterized protein |
Sequence | MSFHEDVGFGDDRIPKSGASFGFSSFSAAAPGRYAPLPQPAAIASISTTGTTRSEAQPIQSVSRKNAGRPQGQACEPPALAVPLTNGKFADYKPWMGGASEDLLNEAVIRSGFVEKLANASSSETNMARPAVWPSLKGKHGLPLLAKLGFEIWPQQIFRCVDSVGQFLTEFEAKYF |
Length | 176 |
Position | Kinase |
Organism | fungal sp. No.11243 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.231 |
Instability index | 47.70 |
Isoelectric point | 7.77 |
Molecular weight | 18838.07 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05822
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.97| 13| 15| 39| 53| 1
---------------------------------------------------------------------------
39- 53 (17.61/14.56) QPaaIASISTTGTTR
57- 69 (23.36/12.92) QP..IQSVSRKNAGR
---------------------------------------------------------------------------
|