<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05819
Description |
Uncharacterized protein |
Sequence | MKRSDGRPPDLEALLSQRSGSIPTRNSAGELTIAPQQTLASRTFCRIHWLGGSVCTLRYQQAASIAVCTHYWNHEVICKSRQIWNQHPRVKSHDMEATHALSSNLRYPGPTLRALDLLQQEQFRKVILMPEVVNQMYEEGLAASEAPAKQS |
Length | 151 |
Position | Middle |
Organism | fungal sp. No.11243 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.485 |
Instability index | 66.38 |
Isoelectric point | 9.04 |
Molecular weight | 17009.19 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05819
No repeats found
No repeats found
|