<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05819
| Description |
Uncharacterized protein |
| Sequence | MKRSDGRPPDLEALLSQRSGSIPTRNSAGELTIAPQQTLASRTFCRIHWLGGSVCTLRYQQAASIAVCTHYWNHEVICKSRQIWNQHPRVKSHDMEATHALSSNLRYPGPTLRALDLLQQEQFRKVILMPEVVNQMYEEGLAASEAPAKQS |
| Length | 151 |
| Position | Middle |
| Organism | fungal sp. No.11243 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.485 |
| Instability index | 66.38 |
| Isoelectric point | 9.04 |
| Molecular weight | 17009.19 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05819
No repeats found
No repeats found
|