<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05815
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MPFMDNDDDMLDLFGDEAVSDIVDRIKDDSNEFGISLNDLGPQVDGLSPETPALFARLDEAYRTGCCHPMVKQGDAWVSKMITPSVDWPHHIIDGKTAFLSVTQSCLLQLVYQQDGQSWSVTSTTLGDGVGAEDILTHSAFADSNQFIYVATFSNRGCLRLYKVSIEWTRSSSDETQNSVLAQLSVEGLQVVGHCQPKPAPDAKGMSTQDLLQSSRLSKLGILPFHSPSAPDSDAFHVVAIFTRAESRTDFGIAVGHCSCIVRWEIVREEPEILDVFKTFKAGNNKMGNLDVSCTYEALYG |
| Length | 301 |
| Position | Tail |
| Organism | fungal sp. No.11243 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.176 |
| Instability index | 48.02 |
| Isoelectric point | 4.59 |
| Molecular weight | 33037.69 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05815
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.85| 19| 86| 135| 153| 1
---------------------------------------------------------------------------
135- 153 (35.94/20.67) ILT.HSAFA.DSNQFIYVATF
222- 242 (27.90/14.75) ILPfHSPSApDSDAFHVVAIF
---------------------------------------------------------------------------
|