<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05809
Description |
Mediator of RNA polymerase II transcription subunit 30 |
Sequence | MTTPPLAQFSGQQQQQTQAARDVNTASLCRIGQETVQDIVLRTMEIFQLLRNMQLPNGVTYHPNTHQDRLGKLQEHLRTLSVLFRKLRLVYDKCNENCAGLEPIPPEQLIPYVEDDSSKLEDRMANQLRAASEERREVLEVNKKLKQKNQQLKMIMDQLRNLIWEINSMLAVRS |
Length | 174 |
Position | Head |
Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.619 |
Instability index | 47.74 |
Isoelectric point | 8.48 |
Molecular weight | 20211.03 |
Publications | PubMed=23594743
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05809
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.83| 15| 16| 107| 121| 2
---------------------------------------------------------------------------
107- 121 (23.92/16.50) EQLIPYVEDDSSKLE
126- 140 (22.91/15.54) NQLRAASEERREVLE
---------------------------------------------------------------------------
|