<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05806
| Description |
Uncharacterized protein |
| Sequence | LTARLRGLCREHAVFLDHEEAFSVPLVNSQSTNPVASASGTTPYVHLRARRSALPNSRELGLWPVLRYLGAVEAGDRLPSKGRNVTPNSLMVEVSAVGSPADDTLQREVVELMELLHPLVIPGRVDHARLACR |
| Length | 133 |
| Position | Head |
| Organism | Hydatigena taeniaeformis (Feline tapeworm) (Taenia taeniaeformis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Taeniidae> Hydatigera.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.110 |
| Instability index | 42.23 |
| Isoelectric point | 8.08 |
| Molecular weight | 14524.47 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05806
No repeats found
No repeats found
|