Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MELQSKIEKLRADCSNSDLQISACQRQLKKQKLDAMVKAVKNPTDVDELIKFAHRISCSYGALAPDNWVPGDPRRPYPNKEEIRRGYLGHLDDSGHFLPTLKDAIAQFQSTAYSPSLSVSNVNVVPSPGGMMSSNGSGSHWIDQQQQLRHLPSSLTAILSSVGSASGRPPRGLPESPSPRIRWQQHQQQVRQGLLGVHSSTPPQAKKRPHIEEPRMCSDTSSDDDGRFGDFTHRGF |
Length | 236 |
Position | Middle |
Organism | Hydatigena taeniaeformis (Feline tapeworm) (Taenia taeniaeformis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda> Eucestoda> Cyclophyllidea> Taeniidae> Hydatigera. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.746 |
Instability index | 67.96 |
Isoelectric point | 9.10 |
Molecular weight | 26116.01 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05799 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 177.88| 43| 48| 86| 128| 1 --------------------------------------------------------------------------- 43- 78 (36.10/16.03) .............PTDVDELIKFAhriSCSYgalAPD.NWVPGDPRRPYP 86- 128 (73.30/39.17) GYLGHLDDSGHFLPTLKDAIAQFQ...STAY...SPS.LSVSNVNVVPSP 136- 179 (68.48/36.17) GSGSHWIDQQQQLRHLPSSLTAIL...SSVG...SASgRPPRGLPESPSP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AKKRPHI 2) GRFGDFTHRGF 3) IRRGYL | 205 226 83 | 211 236 88 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab