<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05797
| Description |
Uncharacterized protein |
| Sequence | MVDIDYKRELEANRERVEDIFDFEGCKVGRGTYGSVFKAKRKDAKDDREYALKQIEGTGLSMSSCREIGLLRELKHPNVMTLHRVFLNHTTRKIWLLFDYAEYDLWHIIKFHRTAKVNKTSFNVYPNMVKSLMYQILNGIDYIHSNWVLHRDLKPANIVVMGEGSERGCVKIGDLGFSRLFYQPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTYEPIFHCRQEDIKTSTPYHKEQLERIFRVMGYPTGSCFFIDEVWPDMRKMPDYPQLMRDSITRKAYGKYYLEGYLMEKKVNMGRYEISLLQSLLTIDPLRRPSAEDALKHDYFKIGEKPNDE |
| Length | 352 |
| Position | Kinase |
| Organism | Hydatigena taeniaeformis (Feline tapeworm) (Taenia taeniaeformis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Taeniidae> Hydatigera.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.411 |
| Instability index | 35.41 |
| Isoelectric point | 8.34 |
| Molecular weight | 41397.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05797
No repeats found
|