<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05797
Description |
Uncharacterized protein |
Sequence | MVDIDYKRELEANRERVEDIFDFEGCKVGRGTYGSVFKAKRKDAKDDREYALKQIEGTGLSMSSCREIGLLRELKHPNVMTLHRVFLNHTTRKIWLLFDYAEYDLWHIIKFHRTAKVNKTSFNVYPNMVKSLMYQILNGIDYIHSNWVLHRDLKPANIVVMGEGSERGCVKIGDLGFSRLFYQPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTYEPIFHCRQEDIKTSTPYHKEQLERIFRVMGYPTGSCFFIDEVWPDMRKMPDYPQLMRDSITRKAYGKYYLEGYLMEKKVNMGRYEISLLQSLLTIDPLRRPSAEDALKHDYFKIGEKPNDE |
Length | 352 |
Position | Kinase |
Organism | Hydatigena taeniaeformis (Feline tapeworm) (Taenia taeniaeformis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Taeniidae> Hydatigera.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.411 |
Instability index | 35.41 |
Isoelectric point | 8.34 |
Molecular weight | 41397.38 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05797
No repeats found
|