| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MCYKESGQSSPSLKDRLQKLDEIESKIMQIMQSAGGTLDELSKDVPSQKQIEIYARSFRDAVRDVELELISQLNYLSQVLAGLPYEKNVYKETIDLTIAAERLKNSLHADSTQDGLPVKNEVSNLLLRTDAVESDPAVTSTVNESELSYSDSSSGKTEVPPSAKPHWRFCSVQTVNSPHFFRSETPQTSVHEFEIPEYEFDDEIPDLEGDLDDDGFGGPMTPEEFIDEDFERELGWYEKASGHSGMFGMYGSTIGIDAYHLDFRGFLLQELSIQEVIDSEFRDISRLGIIQVGVTDHDGRSVFAFFACRLPNTGLIDHDRLLQYVTKTLEQYASSDYTLVYFHWGLTSRNKPSFPWLARAYQTFDRSFKKNLKSLIIVYPTRTVCVLWNLFSAFVSSKMKKKLHYVKNLHDLEDYLPVSQLRLPLRIRDYDSKIGLFGVSLSIDPAAVSVLGDHDIEDGPYNDCQQFGVSLEYIKANNGGRKLPIVVEDTITYLRGHGLDTIGLFVKPVHLMALRDVQSMYNRGEYVDLCEINDPHLAAHLLRSFLTDLKEPLLTFDLYESILKSCSKSEKLCF |
| Length | 574 |
| Position | Head |
| Organism | Hydatigena taeniaeformis (Feline tapeworm) (Taenia taeniaeformis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda> Eucestoda> Cyclophyllidea> Taeniidae> Hydatigera. |
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.323 |
| Instability index | 43.92 |
| Isoelectric point | 4.94 |
| Molecular weight | 65163.77 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro signal transduction GO:0007165 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP05793
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.56| 14| 20| 278| 297| 1
---------------------------------------------------------------------------
282- 297 (20.57/27.75) RDI.....SRLGiiQVGVTDH
300- 318 (20.98/ 7.39) RSVfaffaCRLP..NTGLIDH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 164.01| 54| 66| 403| 465| 3
---------------------------------------------------------------------------
403- 465 (81.11/78.33) LHYVKNlHDLEDYLP..VSQLRLPLRIRDYDSkIGLFgvslsIDPaaVSVLGDHDIED....GPYND.CQ
471- 531 (82.89/54.18) LEYIKA.NNGGRKLPivVEDTITYLRGHGLDT.IGLF.....VKP..VHLMALRDVQSmynrGEYVDlCE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.49| 13| 25| 196| 211| 4
---------------------------------------------------------------------------
196- 211 (16.65/22.33) PEyEFDDEipDLEGDL
222- 234 (25.84/16.04) PE.EFIDE..DFEREL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DRLQKLDEIES 2) FEIPEYEFDDEI 3) MTPEEFI | 15 193 220 | 25 204 226 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab