<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05786
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MEASERQHLESFLLLNSPALKLKQKLFDLLAIVETQRDTADWSKYLTTFGLCASELVEIRKFLESERFASAQSMILTPRALSTEAEPNLAKATDDRLLMFNQDATPLYLRTKLDPRVEALRAAVDARAVSLRTSSSFSPEHALVLHEKLVATLLDDVRLLKQEMDQDQEKLVTVRSAANQDDLFSLVATMSVGRDYAMRMKPDGPK |
| Length | 206 |
| Position | Head |
| Organism | Taenia asiatica (Asian tapeworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Taeniidae> Taenia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.245 |
| Instability index | 35.67 |
| Isoelectric point | 5.50 |
| Molecular weight | 23213.38 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05786
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 118.36| 38| 49| 82| 120| 1
---------------------------------------------------------------------------
82- 120 (57.36/43.99) STEAEPNLAKATDDRLLMFNQDATPLyLRTKLDPRVEAL
134- 171 (61.00/41.34) SSSFSPEHALVLHEKLVATLLDDVRL.LKQEMDQDQEKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.87| 18| 156| 23| 40| 2
---------------------------------------------------------------------------
23- 40 (29.62/17.99) KQKLFDLLAIVETQRDTA
180- 197 (31.25/19.31) QDDLFSLVATMSVGRDYA
---------------------------------------------------------------------------
|