Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSAGIPTRQRLFCQLDEIDGLLKDLLEKINRKVRFDDIEHIVLSLLEKDKEIKETMKTVSEQMELQNRIEKLRVDCGNSDLQISACQKQLKKCELLLSTALYYSRQKLDAMVKAVKNPTDVDDLIKFAHRISCSYGALAPDNWAPGDPRRPYPNKEEIRRGYLGHLDDSGNFLPTLKDAIAQFHSSAPAASTSALTTPAAIETTPTQSTLSSSNRIPNTIPASSESFGNACKFTLCNSSTLSISAYSPSMSASGVNVISSPGGMMPSNGSCSHWMDQQQQPRQLPSSSLTAILSSGGGVGSTGSRPPRGSLPESASPRAMWQQHQQQLRQGLLGGHSSTPPQARKRHVEDSRLCSDTSSDDDGRFGDFTHRGF |
Length | 373 |
Position | Middle |
Organism | Taenia asiatica (Asian tapeworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda> Eucestoda> Cyclophyllidea> Taeniidae> Taenia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.552 |
Instability index | 56.49 |
Isoelectric point | 8.04 |
Molecular weight | 40740.36 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05783 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 172.76| 43| 44| 241| 283| 1 --------------------------------------------------------------------------- 205- 247 (53.48/27.87) PTQSTlSS.SNRIPNtiPASSESFGNA.CKFTL...CNSSTLSISAYS 248- 290 (79.65/44.98) PSMSA.SG.VNVISS..PGGMMPSNGS.CSHWMDQQQQPRQLPSSSLT 291- 330 (39.63/18.81) AILSS.GGgVGSTGSrpPRGSLPESASpRAMWQQHQQQLRQ....... --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 49.72| 15| 17| 14| 28| 2 --------------------------------------------------------------------------- 14- 28 (24.45/18.39) QLDEIDGLLKDLLEK 34- 48 (25.27/19.24) RFDDIEHIVLSLLEK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GRFGDFTHRGF 2) PQARK | 363 341 | 373 345 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab