Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSFAPNYPLQQYPQYFPNKIKIVGTGTNRSVAPCEPFYLLDTEWPMAENQITGATNLIEHYGLKNAYQKYFRGNLKDELSGFLPHLSGNVNMPASADDSGLMGLIERPPIRGKELTIFPASQLDPAVRLHTGQLPQEYMALFMAASPPTTSVAPSNGTASTEGTPATPSNVRKRRRDVHRASAGAVASESAIGPSVTTSASASTISTAAPNLLLRNQQQQQHHHHHHHPPNTAAIAPSVVAAGMAPHSGPLINVAAAAAGVSKPATSAGYFATPPPAAVIRRSAEDFSFMPSSSGGGASSVESPGGDFDDELRRKKRRKEKKSGGGRKERIE |
Length | 332 |
Position | Head |
Organism | Taenia asiatica (Asian tapeworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda> Eucestoda> Cyclophyllidea> Taeniidae> Taenia. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.473 |
Instability index | 61.20 |
Isoelectric point | 9.47 |
Molecular weight | 35309.23 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05769 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.11| 17| 25| 231| 254| 1 --------------------------------------------------------------------------- 234- 250 (31.28/12.15) AIAPSV....VAAGMAPHSGP 256- 276 (23.82/ 9.28) AAAAGVskpaTSAGYFATPPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 83.56| 24| 26| 4| 28| 2 --------------------------------------------------------------------------- 4- 28 (41.79/28.66) APNYPLQQYPQYFP.NKIKIVGtGTN 32- 56 (41.77/24.20) APCEPFYLLDTEWPmAENQITG.ATN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 102.07| 33| 37| 73| 109| 3 --------------------------------------------------------------------------- 73- 109 (51.10/43.04) GNlkdELSGFlP..HLSGNVNMPASADDSGLMGLI..ERPP 112- 148 (50.97/30.88) GK...ELTIF.PasQLDPAVRLHTGQLPQEYMALFmaASPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 140.27| 34| 139| 151| 184| 4 --------------------------------------------------------------------------- 151- 184 (57.27/32.15) SVAPSN..GT...ASTEGTPA..TPSNVRKRRRDVHRASAG 191- 223 (37.04/18.32) AIGPSV..TTsasASTISTAA..PNLLLRNQQQQQHH.... 288- 325 (45.97/24.42) SFMPSSsgGG...ASSVESPGgdFDDELRRKKRRKEKKSGG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ASSVESPGGDFDDELRRKKRRKEKKSGGGRKERIE 2) YFATPPPAAVIRRSAEDFSFMPS | 298 270 | 332 292 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab