<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05765
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSRIPEGPTHVSLFPIPPWELINKYTDSAVADGTAPPPPHIPSSTSYQMFGIRYNTDDPILRPLESFGFKRVYPQTYSRKAELKKLNFSILTNYLDLLDVITRDPSSPKRKEKLDHIGLLFINMHHLLNEYRPHQARDLVREMLTYQVRIASETVHQSEQYLARANETLSLAAQTISTGSQGSSSISSVSFADLGPELDAFLTGIQTDMKNNPQRTNVKIADEDAETPQLLDQASEKPSDDSRDDALDPCIWSFLQEN |
Length | 258 |
Position | Middle |
Organism | Mesocestoides corti |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Mesocestoididae> Mesocestoides.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.542 |
Instability index | 43.34 |
Isoelectric point | 5.16 |
Molecular weight | 29089.28 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05765
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.73| 20| 131| 96| 115| 2
---------------------------------------------------------------------------
96- 115 (34.46/19.99) DLLDVITRDPSSPKRKEKLD
229- 248 (34.28/19.85) QLLDQASEKPSDDSRDDALD
---------------------------------------------------------------------------
|