<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05764
| Description |
Uncharacterized protein |
| Sequence | LRDSLKSIKENYDMILSRGKMDNQAVISRSDSYAQAAQENFECNVRGANIVNACENITRLLSEVKQLLILGDFCWLELITKEGAEERNRRRTELDAVAMQLRDEISRDLYALEETLGASSSRRRSPLSQETEDKKLES |
| Length | 138 |
| Position | Head |
| Organism | Mesocestoides corti |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.650 |
| Instability index | 85.88 |
| Isoelectric point | 5.06 |
| Molecular weight | 15771.55 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05764
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.59| 11| 31| 83| 94| 1
---------------------------------------------------------------------------
83- 94 (15.58/13.88) GAeERNRRRTEL
117- 127 (20.01/12.37) GA.SSSRRRSPL
---------------------------------------------------------------------------
|