<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05756
Description |
Uncharacterized protein |
Sequence | MDGQYQMPGAAVLRKPPLQQQQQQQPPQMMMQPPAASLPPESFVYEAPEGQVPSSLMATSALIEQTRIDPSIAESLAMANNFTGPSSQSRGATMQETFIQGVVSVNQVEMLTTRLRGLCREYSPFYDHEEAFSVAVVSAQTTNPIASASGTTPYVQLRVRKSLLPNARDLGIWPVLRYLGAVESDDKVQLRGNCYNAPPPALYNMHVVICRRSYLEACVNGPLVGFLKSLGFKKDFEFLAEGEVYVRGRAKVLIYAVFEVVYPPGSDIHLLAPCKGRNVAPASLMVEVSAVGSPADETLQREVVDLMELLHPLVVPGRVDHARLACR |
Length | 327 |
Position | Head |
Organism | Mesocestoides corti |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Mesocestoididae> Mesocestoides.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.080 |
Instability index | 48.85 |
Isoelectric point | 6.00 |
Molecular weight | 35815.82 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05756
No repeats found
|