Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSYAGNCTPQQSGQMFVNKIKIIRTGGNRTVKNTLEPFYLLEPEWPLTDNQITGAKNLIDHYGLKNAYQKYFRGNLKEELSGFLTHLSGNVNTPSSSDESGLMHLIERPPIQGNSFQTFNISQLDSAVRLHPGPLPQEFMSYFVAPSPTPNATSNGPSSNEAGSTPSAKKRRRDVHRSGVGSVASSDYAPSSSLSHFPSSNPSSAMVRGQPHQSVHHTSNQHHHPSSAAMAPHSGPLMNPSVASSLSSGISKPATSVGYFATPPAAMKRPLDELYNSQTPSGLASSVESPGGGGYDFDDEIRRKRRRKEKKSGGSSSRRDRID |
Length | 323 |
Position | Head |
Organism | Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda> Eucestoda> Cyclophyllidea> Hymenolepididae> Rodentolepis. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.742 |
Instability index | 69.15 |
Isoelectric point | 9.60 |
Molecular weight | 34920.30 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05744 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 149.75| 32| 35| 172| 203| 1 --------------------------------------------------------------------------- 145- 188 (39.79/16.58) APSptpNA..TSN.G.PSSNeagstPS....................akkrRRDVHRSGVGSVASSDY 189- 223 (52.08/23.94) APS...SS..LSH.F.PSSN.....PS....................samvRGQPHQS.VHHTSNQHH 224- 265 (33.46/12.80) HPS...SAamAPH.SgPLMN.....PS...............vasslssgiSKP..ATSVGYFATPPA 266- 320 (24.43/ 7.40) AMK...RP..LDElY.NSQT.....PSglassvespggggydfddeirrkrRRKEKKSG.GSSSRRD. --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RPLDELY 2) SVESPGGGGYDFDDEIRRKRRRKEKKSGGSSSRRDRID | 269 286 | 275 323 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab