<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05744
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSYAGNCTPQQSGQMFVNKIKIIRTGGNRTVKNTLEPFYLLEPEWPLTDNQITGAKNLIDHYGLKNAYQKYFRGNLKEELSGFLTHLSGNVNTPSSSDESGLMHLIERPPIQGNSFQTFNISQLDSAVRLHPGPLPQEFMSYFVAPSPTPNATSNGPSSNEAGSTPSAKKRRRDVHRSGVGSVASSDYAPSSSLSHFPSSNPSSAMVRGQPHQSVHHTSNQHHHPSSAAMAPHSGPLMNPSVASSLSSGISKPATSVGYFATPPAAMKRPLDELYNSQTPSGLASSVESPGGGGYDFDDEIRRKRRRKEKKSGGSSSRRDRID |
| Length | 323 |
| Position | Head |
| Organism | Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Hymenolepididae> Rodentolepis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.742 |
| Instability index | 69.15 |
| Isoelectric point | 9.60 |
| Molecular weight | 34920.30 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05744
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 149.75| 32| 35| 172| 203| 1
---------------------------------------------------------------------------
145- 188 (39.79/16.58) APSptpNA..TSN.G.PSSNeagstPS....................akkrRRDVHRSGVGSVASSDY
189- 223 (52.08/23.94) APS...SS..LSH.F.PSSN.....PS....................samvRGQPHQS.VHHTSNQHH
224- 265 (33.46/12.80) HPS...SAamAPH.SgPLMN.....PS...............vasslssgiSKP..ATSVGYFATPPA
266- 320 (24.43/ 7.40) AMK...RP..LDElY.NSQT.....PSglassvespggggydfddeirrkrRRKEKKSG.GSSSRRD.
---------------------------------------------------------------------------
|