<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05740
Description |
Uncharacterized protein |
Sequence | MKQLSSPSLAAFHSCASMRCWRLCISFKGLPANPDLLYQSPETPVNSLRDLTNFLHSVVTEWEGLCRLFAICAPVLDKSASFPPGIVVQLFDAKSLILAYGPGLHYRPLWEPLNLPDDAIDLCDYHVVGGVFQFDLLKLPRQPRTGRGWNWTNCVVPPILTPLEYTVGTPKIEPDAIEGTPDNSVKEGSGKEENQEIKVDDQVDVDKNAMWCKVVFYYSV |
Length | 220 |
Position | Tail |
Organism | Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Hymenolepididae> Rodentolepis.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.095 |
Instability index | 36.56 |
Isoelectric point | 5.07 |
Molecular weight | 24582.96 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05740
No repeats found
No repeats found
|