<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05737
Description |
Uncharacterized protein |
Sequence | MEKPGDGVLDEFERQCDNLLLSLSSMDFSPQSNFAECRFGDVSENFIESCRDLDSWFTCKRFIINTKFPEYELTNEINRLRKELEDKQTYLNYLRGKISAYVSSIDVITEKLSDGVAYVPDV |
Length | 122 |
Position | Head |
Organism | Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Hymenolepididae> Rodentolepis.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.452 |
Instability index | 45.75 |
Isoelectric point | 4.47 |
Molecular weight | 14142.70 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05737
No repeats found
No repeats found
|