<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05734
| Description |
Uncharacterized protein |
| Sequence | MADRLTELQDIINLQAENLYNAIGVIQQLAQPSFFSDLNHKGRREKEWASNPELQSLLQGQTGEDYALKYAISIADCAKKIEILINSLPAEETAPDVQDEATKDLFSDYRKQSAKLYNLITKSFQTRLSKVRFLIGRISETQLLTRALENEVCVISFRVLSTLCPFYCKFSDRYTTTSIMDLMQPEIPEKTESDIYFSWLNFLSLCLGSIFFARLFGILLPLALPKVVQYVLPSCRASRAASKRRDSELLELRSKMSKLNMVDNFAAYSKLQRKVNSLVRDQNETDRSQLGITLVSSLVAQVIRYILHGILLAWLFSRTPTDRLTNDQLAVLKETYAFVGWLVTCIHYIPGWLITMLWISLCEVTSTRFLSMFQQWFETDRGNENFLQTAANFAAASSTF |
| Length | 400 |
| Position | Middle |
| Organism | Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Hymenolepididae> Rodentolepis.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.037 |
| Instability index | 43.25 |
| Isoelectric point | 7.51 |
| Molecular weight | 45729.17 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05734
No repeats found
|