Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MCTGIPTKQKLLAQFEDLDCLLKDLLDKVNRRPRYDDIEHIIFSLLDKDKELKATLQTVSEQMEIQTKIERIRADCENSDAQINACQQNLKKCELLQKLDSMVKAVKNPTDIDELIKYAHRISCTYGSVAPDNWTPGDPRRPYPNKEEIRRGYLGHLDDSGKFLPTLKDAVAQFQPSVNTPAAGAVEATPSQQQMSLASSAQLPNLTSVSSESLENSSIYSPSAVLPGVNITPSPGGMGPSNGSGSGWIEPRHTTSLNAILSGGGSAGNNNRLSGYQSESPSPNMWHQQQLRQTLPGVHTSTPPQQQIKRPLDDMRMYSDNSEDDGGLGF |
Length | 330 |
Position | Middle |
Organism | Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda> Eucestoda> Cyclophyllidea> Hymenolepididae> Rodentolepis. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.653 |
Instability index | 61.88 |
Isoelectric point | 5.46 |
Molecular weight | 36207.15 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05730 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 197.31| 65| 106| 31| 101| 1 --------------------------------------------------------------------------- 31- 101 (95.60/83.41) RRPrYDDIEHI...IFSLLDKDKELKATLQTVSEQmeIQTKIERIRAD.CENSDAQinaCQQNLKKCELLQKLDS 140- 208 (101.71/69.10) RRP.YPNKEEIrrgYLGHLDDSGKFLPTLKDAVAQ..FQPSVNTPAAGaVEATPSQ...QQMSLASSAQLPNLTS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IRRGYL 2) QIKRPLDDMRMYS 3) RHTTSLNAIL | 149 307 252 | 154 319 261 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab