| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MCTGIPTKQKLLAQFEDLDCLLKDLLDKVNRRPRYDDIEHIIFSLLDKDKELKATLQTVSEQMEIQTKIERIRADCENSDAQINACQQNLKKCELLQKLDSMVKAVKNPTDIDELIKYAHRISCTYGSVAPDNWTPGDPRRPYPNKEEIRRGYLGHLDDSGKFLPTLKDAVAQFQPSVNTPAAGAVEATPSQQQMSLASSAQLPNLTSVSSESLENSSIYSPSAVLPGVNITPSPGGMGPSNGSGSGWIEPRHTTSLNAILSGGGSAGNNNRLSGYQSESPSPNMWHQQQLRQTLPGVHTSTPPQQQIKRPLDDMRMYSDNSEDDGGLGF |
| Length | 330 |
| Position | Middle |
| Organism | Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda> Eucestoda> Cyclophyllidea> Hymenolepididae> Rodentolepis. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.653 |
| Instability index | 61.88 |
| Isoelectric point | 5.46 |
| Molecular weight | 36207.15 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP05730
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 197.31| 65| 106| 31| 101| 1
---------------------------------------------------------------------------
31- 101 (95.60/83.41) RRPrYDDIEHI...IFSLLDKDKELKATLQTVSEQmeIQTKIERIRAD.CENSDAQinaCQQNLKKCELLQKLDS
140- 208 (101.71/69.10) RRP.YPNKEEIrrgYLGHLDDSGKFLPTLKDAVAQ..FQPSVNTPAAGaVEATPSQ...QQMSLASSAQLPNLTS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IRRGYL 2) QIKRPLDDMRMYS 3) RHTTSLNAIL | 149 307 252 | 154 319 261 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab