Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDSSKNNEPSPYEILWQDPSFPVHQLNASNVLQYFCHLSNPFYDRESNNEVVRMQGLGLDRLTSLLGIEYYLCYCQEPSLFVIRKQDRISPSEVMPLAYYYVVNGVVRQCPDLGTLINSRIHSITANLNKIIQELAPCARFHPSDGSYSWQNPKAEVTETTKEVKKKPTDDLVATNPYQVHRTDFLLNEWASRFPPMQLQTLSASQTPSAVTDAPPDRRPKLM |
Length | 223 |
Position | Head |
Organism | Hymenolepis diminuta (Rat tapeworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda> Eucestoda> Cyclophyllidea> Hymenolepididae> Hymenolepis. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.497 |
Instability index | 49.84 |
Isoelectric point | 5.95 |
Molecular weight | 25496.58 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05726 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.96| 24| 28| 43| 70| 1 --------------------------------------------------------------------------- 43- 70 (36.00/37.91) YDRESNNEVVRMQglglDRLTS..LLGIEY 74- 99 (39.97/29.57) YCQEPSLFVIRKQ....DRISPseVMPLAY --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DRRPKLM 2) SPYEILWQ | 217 10 | 223 17 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab