<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05722

Description Uncharacterized protein
SequenceMVDINFKRELDAKRERVEDIFNFEGCKVGRGTYGSVFKAKRKDGSDEREYALKQIEGTGLSMSSCREIGLLRELKHRNVMTLHRIFLNHTTRKIWLLFDYAEYDLWHIIKFHRTAKANKSFFAVSQNMVKSLMYQILNGIHYIHSCWVLHRDLKPANIVVMGEGPERGCVKIGDLGFSRIFYSPLKPLADLDPVVVTFWYRAPELLLGARHYNKAIDVWAIGCIFAELLTYEPIFHCRQEDIKTSTPYHKEQLERIFRVMGYPSEETWPEMRTMPDYPQLSRDSITRKAYGKYYLEGYLMEKKVHMGQNEISLLKSLLTMDPTKRPSAEEALQHDYFRTGDKPNEDVFGGMPIPYPKREFITDDDQDDNKQQQGGAKGGAVAQQQPPPPQAPQQQAKVPQQQGPPPPNQQHTVPHYPSAQVQPPM
Length425
PositionKinase
OrganismHymenolepis diminuta (Rat tapeworm)
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda> Eucestoda> Cyclophyllidea> Hymenolepididae> Hymenolepis.
Aromaticity0.10
Grand average of hydropathy-0.619
Instability index52.09
Isoelectric point8.52
Molecular weight49103.66
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05722
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.51|      28|      35|     352|     386|       1
---------------------------------------------------------------------------
  352-  386 (46.90/36.37)	PIPY.PKRefitdddQDDNKQQQGGA........KGGAVAQQQP
  387-  423 (46.61/23.28)	PPPQaPQQ.......QAKVPQQQGPPppnqqhtvPHYPSAQVQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.46|      15|      35|     152|     166|       2
---------------------------------------------------------------------------
  152-  166 (26.80/18.58)	DLKPANIVVMGEGPE
  190-  204 (28.66/20.38)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     103.66|      29|      41|     225|     254|       3
---------------------------------------------------------------------------
  225-  254 (48.54/39.45)	FAELLTYePIFHCRQEDIKTSTPYHKEQLE
  268-  296 (55.12/39.93)	WPEMRTM.PDYPQLSRDSITRKAYGKYYLE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05722 with CDK8 domain of Kingdom Metazoa
Unable to open file!