<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05714
Description |
Uncharacterized protein |
Sequence | MQSMVRFGTSSQQAHSRKKDTYLNNLNSRLRESLKSIQENFEMMLSRAKLENQAILCRCDPYSLVTQENFEYNVRAANIVNACEGITRLVSEIKLLLILGDFRWLETSVNEEAEERECRFSDLMEVTSRLCESISRDLVSLEEVLGCTPRRPRDQTISSESNFENNAFKFRPLN |
Length | 174 |
Position | Head |
Organism | Hymenolepis diminuta (Rat tapeworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Hymenolepididae> Hymenolepis.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.518 |
Instability index | 48.33 |
Isoelectric point | 5.41 |
Molecular weight | 20183.63 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05714
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.52| 15| 27| 38| 52| 1
---------------------------------------------------------------------------
38- 52 (26.80/18.31) QENFEMMLSRAKLEN
67- 81 (26.72/18.25) QENFEYNVRAANIVN
---------------------------------------------------------------------------
|