<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05711
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MCAGVPTKQKLFSQLEDLDYLLKELLDKVNRRSRYDDIEHTIFSLLDKDKELKATLQTVSEQMEVQLKIEKLRADCENSDAQINACQHHLKKCELLLCTALFYSRQKLDSMVKAVKNPTDIDELIKYAHRISCTYGAVAPDNWTPSDPRRPYPNKEEIRRGYLGHLDDSGKFLPTLKDAVAQFQPNINTPAASSIEVSLSQQQMSLTSSTQLPNPTSVSSESLENSSVYSPSVGMSGINITPSPGGMVPSNGSGSGWIEPRHPTSSLNAILSGGGSSGNSNRPSGYPSESPSPNMWHQQQQLRQTLPGVHSSTPPQQQIKQPHPDDMRTYSDNSDDDGGLGF |
| Length | 342 |
| Position | Middle |
| Organism | Hymenolepis diminuta (Rat tapeworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Hymenolepididae> Hymenolepis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.688 |
| Instability index | 65.32 |
| Isoelectric point | 5.73 |
| Molecular weight | 37701.66 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05711
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.12| 18| 60| 244| 263| 2
---------------------------------------------------------------------------
244- 263 (32.48/22.59) PGgmVPSNGSGSGWIEPRHP
307- 324 (36.64/19.02) PG..VHSSTPPQQQIKQPHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.25| 16| 18| 13| 28| 3
---------------------------------------------------------------------------
13- 28 (26.15/18.48) SQLEDLDYLLKELLDK
33- 48 (28.10/20.35) SRYDDIEHTIFSLLDK
---------------------------------------------------------------------------
|