Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MCAGVPTKQKLFSQLEDLDYLLKELLDKVNRRSRYDDIEHTIFSLLDKDKELKATLQTVSEQMEVQLKIEKLRADCENSDAQINACQHHLKKCELLLCTALFYSRQKLDSMVKAVKNPTDIDELIKYAHRISCTYGAVAPDNWTPSDPRRPYPNKEEIRRGYLGHLDDSGKFLPTLKDAVAQFQPNINTPAASSIEVSLSQQQMSLTSSTQLPNPTSVSSESLENSSVYSPSVGMSGINITPSPGGMVPSNGSGSGWIEPRHPTSSLNAILSGGGSSGNSNRPSGYPSESPSPNMWHQQQQLRQTLPGVHSSTPPQQQIKQPHPDDMRTYSDNSDDDGGLGF |
Length | 342 |
Position | Middle |
Organism | Hymenolepis diminuta (Rat tapeworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda> Eucestoda> Cyclophyllidea> Hymenolepididae> Hymenolepis. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.688 |
Instability index | 65.32 |
Isoelectric point | 5.73 |
Molecular weight | 37701.66 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05711 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.12| 18| 60| 244| 263| 2 --------------------------------------------------------------------------- 244- 263 (32.48/22.59) PGgmVPSNGSGSGWIEPRHP 307- 324 (36.64/19.02) PG..VHSSTPPQQQIKQPHP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.25| 16| 18| 13| 28| 3 --------------------------------------------------------------------------- 13- 28 (26.15/18.48) SQLEDLDYLLKELLDK 33- 48 (28.10/20.35) SRYDDIEHTIFSLLDK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IRRGYL 2) QIKQPHPDDMRT | 158 318 | 163 329 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab