<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05700
| Description |
Uncharacterized protein |
| Sequence | MSYMLPHLSNGWQVDQAILAEEDRVVLIRFGHDWDPSCMRMDESQMTLYKIANKVKNFAVIYLVDTTEVPDFNKMYELYDPCTVMFFFRNKHIMVDLGTGNNNKINWPITDGQELIDILETVYRGARKGRGLVQKLKFQTMADRLTQLQDLVNELANLMCNSIGVLRLTAPPCDFNGTSKALEDEENCSLFAATIAHTAKDIEILIDSLPIDEPAASNSEIDATLLNMDEQRHRAARELEQAVIDGEELIKKIQKALAEIARVRMLSRPFI |
| Length | 271 |
| Position | Middle |
| Organism | Elaeophora elaphi |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Elaeophora.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.203 |
| Instability index | 40.28 |
| Isoelectric point | 4.93 |
| Molecular weight | 30855.14 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
U4/U6 x U5 tri-snRNP complex GO:0046540 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | mRNA splicing, via spliceosome GO:0000398 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05700
No repeats found
|