<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05700
Description |
Uncharacterized protein |
Sequence | MSYMLPHLSNGWQVDQAILAEEDRVVLIRFGHDWDPSCMRMDESQMTLYKIANKVKNFAVIYLVDTTEVPDFNKMYELYDPCTVMFFFRNKHIMVDLGTGNNNKINWPITDGQELIDILETVYRGARKGRGLVQKLKFQTMADRLTQLQDLVNELANLMCNSIGVLRLTAPPCDFNGTSKALEDEENCSLFAATIAHTAKDIEILIDSLPIDEPAASNSEIDATLLNMDEQRHRAARELEQAVIDGEELIKKIQKALAEIARVRMLSRPFI |
Length | 271 |
Position | Middle |
Organism | Elaeophora elaphi |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Elaeophora.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.203 |
Instability index | 40.28 |
Isoelectric point | 4.93 |
Molecular weight | 30855.14 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
U4/U6 x U5 tri-snRNP complex GO:0046540 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | mRNA splicing, via spliceosome GO:0000398 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05700
No repeats found
|