<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05696

Description Uncharacterized protein
SequenceMFGAGQQSSSTAQPTGVNIAIEAGSEWGIQEIGFDGVEKYMRPLDYSDHVAKLARKVDWRKLIGAEATYDNPDALPRDDGEELEDREPEEVVIGMEDRKTPEAGPWHTVAKFLHEALQQVNVLVDTISVLKTPYMEALTVADAFEVQHNMQDVVQQSKQFQWVTRRKALGEAIGVLEQAQKFRSKLLTETDPDKAMFFRELEKMRELWRVRKTGNVTYGDLGYKMFGSKYNPKELFDITRRTAISAGDGATRSDSCLQVQVPCDLIRRSSIAVSIEIDNDDPKTLFATAENDLDYMKVDKEQAMAVHWSKALQWAQESLLCRDIFKQLCKDAIILKDHITIIRDGVLIASLFDNILLRVELSFHPFEDGPLPTVGDDYLNRALRQLFVSDLCTRNIRHQTFVAMPLSTLPSTLDLRGPYAMTDEEIESRLRQKRTLLERLLLLASHFVLTNRVTTSLKRYLLRVTDPQVMWKWLRATPVQSSIIVTASNRNYDYAGKTTFYIRIGAENFYIATKEGQNIECRRDDEMLIYSIDMLICNYMLNTVAMIASKLWQWQVLHANINAMDDRAEPSPTVYMCNQSATRAIFMQFHLNEPPTIRIRKCAPNKPAAAEQPGEFLVLNYDRLVGSSLCRKIDNLCSMLRS
Length642
PositionHead
OrganismElaeophora elaphi
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Elaeophora.
Aromaticity0.08
Grand average of hydropathy-0.308
Instability index52.05
Isoelectric point5.81
Molecular weight73276.12
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP05696
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.34|      24|      26|     196|     220|       1
---------------------------------------------------------------------------
  196-  220 (38.66/32.91)	MFFRELEKmRELWRVRKTGNVTYGD
  225-  248 (41.68/29.68)	MFGSKYNP.KELFDITRRTAISAGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     113.83|      32|     237|     275|     314|       3
---------------------------------------------------------------------------
  131-  162 (57.32/30.97)	KTPYMEALTVADAFEVQHNMQDVVQQSKQFQW
  283-  314 (56.51/30.36)	KTLFATAENDLDYMKVDKEQAMAVHWSKALQW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.70|      22|     263|     101|     122|       5
---------------------------------------------------------------------------
  101-  122 (41.32/32.06)	P.EAGPWHTVA.KFLHEALQQVNV
  365-  388 (30.38/21.49)	PfEDGPLPTVGdDYLNRALRQLFV
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP05696 with Med17 domain of Kingdom Metazoa

Unable to open file!