| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MTERYMPSIFPECDKLKQIYDKCFSDFFEKFISTEASAVSNPCGRLHETYRHCIEKLFHHKIILELEGESMDPSLMGSMSNAPVLQETATDTRYNQLEQTLENFQENARQMGVIASDFTTRSQEPLNQKIHTLISGLHELDHLKNQFMDVKIPLELLEYLDQGKNPQLYTKECLERTLNKNKEMNGKIEMYKKFRAMLLKELGEEMPNDMILYRNLRDRKDASPQHENYNEDASD |
| Length | 235 |
| Position | Middle |
| Organism | Elaeophora elaphi |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Elaeophora. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.771 |
| Instability index | 45.73 |
| Isoelectric point | 5.27 |
| Molecular weight | 27584.02 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP05690
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.22| 31| 35| 144| 178| 1
---------------------------------------------------------------------------
144- 178 (48.44/40.19) KNQFMDVKIPL......ELLEYLDQGKNPQLytkeCLERTL
180- 216 (47.78/29.65) KNKEMNGKIEMykkfraMLLKELGEEMPNDM....ILYRNL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.98| 20| 28| 13| 40| 2
---------------------------------------------------------------------------
13- 32 (38.40/32.58) CDKLKQIYDKCFSDFFE.KFI
43- 63 (34.59/14.82) CGRLHETYRHCIEKLFHhKII
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DMILYRNLRDRKD 2) QHENYNEDA | 209 225 | 221 233 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab