<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05686
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MDFTGFYDATSSNQYVERTHSSAPFMPRGTPISPSQQLTASPHHHHQHHQQHQPSVLENLINSSHYGSPMQSSQHVNGSGNQSVSDLPFGNAMQQNDERMYTEKLRSLRPYVESLRARAQQCRLEGNEIAASKFDTMCNVLDGKSRVSFEYLLQIEAWIYKKQQFLVSNIVCMLRIDLTTKYVSSSILQRKQVSLNTGTLQPQPLVDAVNAVLLINSEAQVGYGDRVQTNTGVPSAGQWSVQSSRSQQQASSQGLPNMVPSSVPVAHCPVRSTLMQSSIPLQTTSGQQVARHSIEHTYQRHSPYPNPNXXXXXDYVPQPAATVAALPPFSEANRAPATTDCSRVEDLYVMDDFLPTPIEAVSNNTSSQMEGLLPEAVRQELLAFGDRILADSNIEQMTDSHSVIVKFSLTSHNVPPLQLIIPKAYPNGEVMVGRAALDLDSFFFDDLQNVIHERLARPGLRTVTDFLETWESTVRGYYLGQQQQSLLPNSFDDILQNTNFSDFLS |
Length | 505 |
Position | Tail |
Organism | Brugia timori |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Brugia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.433 |
Instability index | 61.00 |
Isoelectric point | 5.69 |
Molecular weight | 55664.54 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05686
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.35| 29| 112| 347| 375| 1
---------------------------------------------------------------------------
347- 375 (51.25/32.25) LYVMDDFLPTPIEAVSN.NTSSQMEGLLPE
460- 489 (47.11/29.09) LRTVTDFLETWESTVRGyYLGQQQQSLLPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.14| 22| 25| 233| 256| 3
---------------------------------------------------------------------------
233- 256 (34.61/22.17) VPSAGQWSVQSSRSQQQASSqgLP
259- 280 (40.53/20.24) VPSSVPVAHCPVRSTLMQSS..IP
---------------------------------------------------------------------------
|