<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05683
Description |
Uncharacterized protein |
Sequence | LVMWSQEGSVPRARISPGIVIDQTNISVLILLCLRPARHNPSEKNADASKHLIPLIYNTQTNTVARRSSGADDDASNATTVLSNISEQYSLTNEPALWPAIYSLAHNFTVQR |
Length | 112 |
Position | Tail |
Organism | Brugia timori |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Brugia.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.221 |
Instability index | 52.33 |
Isoelectric point | 7.02 |
Molecular weight | 12312.71 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05683
No repeats found
No repeats found
|