<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05674
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MRYDRTAYDKCFSDFFEKFISAETLTVSNPCDRLHETYRYCIEKNLEKNKIYDIDLNELRKDVLNTKDDLLKELKGKLMDPSLMGSMSNAPILQETATDTRYNHLEQTLENFQENARQMGVIASDFSTRSQEPLNQKIHTLISGLHELDHLKNQFMDVKIPLELLEYLDQGKNPQLYTKECLERTLNKNKEMNGKIEMYKKFRAMLLKELGEEMPNDMVLYRNLRDRKDASPQHENCNEDASD |
Length | 243 |
Position | Middle |
Organism | Brugia timori |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Brugia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.866 |
Instability index | 32.53 |
Isoelectric point | 5.31 |
Molecular weight | 28619.15 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05674
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 102.18| 32| 74| 71| 114| 1
---------------------------------------------------------------------------
71- 104 (49.37/28.20) LKELKGKLMDPSLmgSMSNAPILQETATDTRYNH
148- 179 (52.81/29.56) LDHLKNQFMDVKI..PLELLEYLDQGKNPQLYTK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.33| 14| 21| 190| 203| 4
---------------------------------------------------------------------------
190- 203 (25.03/12.62) KEMNGKIEMYKKFR
212- 225 (25.31/12.82) EEMPNDMVLYRNLR
---------------------------------------------------------------------------
|