Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | LIEMDSIGSGVASSGSLRTKISLKGRYSQLSLVCPFHLMKPELPQQSVLLGSNDLLAEYDMGSSYQRFCGSKRLREDLGSFLPHLVGSFNFENALEFSSLRMLVEKPPITGKEITSLSAGAMAGFRLTPGAVPEPYRYFDNKVDDLSSDTMNYDENGEETKHKRKYKWSLDDLDDADLDRKYRKHRSEDKDRKKEKKKKKDKKRKRDSKEEDQNNKVRKV |
Length | 220 |
Position | Head |
Organism | Brugia timori |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Brugia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.962 |
Instability index | 41.86 |
Isoelectric point | 9.20 |
Molecular weight | 25221.29 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05669 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 69.46| 15| 15| 181| 195| 1 --------------------------------------------------------------------------- 165- 179 (23.32/11.58) KYKWSLDDLDDADLD 181- 195 (24.09/12.17) KYRKHRSEDKDRKKE 197- 211 (22.05/10.59) KKKKDKKRKRDSKEE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.94| 15| 16| 60| 74| 2 --------------------------------------------------------------------------- 53- 71 (24.36/13.20) NDLlaeyDMGSSYQRFCGS 72- 88 (22.58/11.83) KRL..reDLGSFLPHLVGS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.07| 19| 26| 104| 122| 3 --------------------------------------------------------------------------- 104- 122 (31.56/19.30) VEKP.PITGKEITSLSAGAM 132- 151 (29.50/17.67) VPEPyRYFDNKVDDLSSDTM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DLDRKYRKHRSEDKDRKKEKKKKKDKKRKRDSKEEDQNNKV 2) PYRYFDN | 177 135 | 217 141 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab