<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05662
Description |
Uncharacterized protein |
Sequence | MSACREIALLRELKHPNLIKLQRVFLTTDRKVWLLFDYAEHDLWHIIKFHRAAKQKKQPVLVPKGMVKSLLYQILDGIHYLHSNWILHRDLKPANILVMGEGPGVERGRVKIGDMGFARIFHNPLKPLAELDPVVVTFWYRAPELLLGAKHYTKAIDIWAIGCIFAELLTSEPVFFCREEDIKASSPYHQDQLNRIFTVMGYPSESDWQDLKKMPEYQKLTQDFKRANYANCTLQRYMDKHKIKADTRSFSLLQRLLTMDPIKRVTAQDAMDDAYFKEDPRPTADVFSGCDIPYPKREFLSDENDDKSASASKPQQVQPPQQSQQQVGCMYSVL |
Length | 334 |
Position | Kinase |
Organism | Brugia timori |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Brugia.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.416 |
Instability index | 51.68 |
Isoelectric point | 8.72 |
Molecular weight | 38754.38 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05662
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.58| 14| 16| 260| 275| 4
---------------------------------------------------------------------------
260- 275 (21.89/18.55) DPikRVTA..QDAMDDAY
279- 294 (23.69/13.19) DP..RPTAdvFSGCDIPY
---------------------------------------------------------------------------
|