<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05653
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MGDRRMPSIFPECDQLKQDYDKCFTDFFQKFIASSYRHSYTVNPCDRLHRIYRDCVEQLRLMESLQSNLPHPQIISDSGESRFNQLERILEQFQENARHLGVIATDFGARSQEPFNQKIHTLVSGLQELDQMRSQFMDVKVPLELLDVLDQGKNPQLYTKEVLERTLLKNKEVNGKVETYKKLRAALLKELGEEMPEDTMTYRNIRDIMEKQ |
Length | 212 |
Position | Middle |
Organism | Angiostrongylus costaricensis (Nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Metastrongyloidea> Angiostrongylidae> Angiostrongylus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.722 |
Instability index | 50.72 |
Isoelectric point | 5.81 |
Molecular weight | 25008.23 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05653
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.95| 18| 21| 167| 187| 1
---------------------------------------------------------------------------
167- 184 (29.61/20.29) LLKN..KEVNGKVETYKKLR
187- 206 (27.34/13.44) LLKElgEEMPEDTMTYRNIR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.36| 20| 21| 93| 112| 2
---------------------------------------------------------------------------
65- 90 (20.71/11.33) LQSNLPHP..QIISdsgeSRFNqlERIL
93- 112 (34.39/22.79) FQENARHL..GVIA....TDFG..ARSQ
115- 135 (25.26/15.15) FNQKIHTLvsGLQE....LD.Q..MRSQ
---------------------------------------------------------------------------
|